- ZRANB1/Trabid Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86918
- Unconjugated
- Human
- TRABID
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- ZRANB1/Trabid
- Immunohistochemistry, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: SSGNSQRRSP PATKRDSEVK MDFQRIELAG AVGSKEELEV DFKKLKQIKN RMKKTDWLFL NACVGVVEGD LAAIEAYKSS GGDIARQLT
- zinc finger RANBP2-type containing 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Cancer, DNA Repair, DNA replication Transcription Translation and Splicing
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
SSGNSQRRSPPATKRDSEVKMDFQRIELAGAVGSKEELEVDFKKLKQIKNRMKKTDWLFLNACVGVVEGDLAAIEAYKSSGGDIARQLT
Specifications/Features
Available conjugates: Unconjugated